PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04763.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 635aa    MW: 69923.8 Da    PI: 10.7241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04763.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.4e-19217262147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+W++eEd+ l ++v+++G ++W+tI r+++ gR++k+c++rw + 
  Zmw_sc04763.1.g00030.1.am.mk 217 RGPWSPEEDDMLRRLVERHGARNWTTIGREIP-GRSGKSCRLRWCNQ 262
                                   89******************************.***********985 PP

2Myb_DNA-binding46.96.5e-15264302545
                                   -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   +++Ed  +v+a+++lG++ W++Iar ++ gRt++ +k++w+
  Zmw_sc04763.1.g00030.1.am.mk 264 SPQEDAAIVRAHARLGNR-WAAIARLLP-GRTDNAVKNHWN 302
                                   89****************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.2E-17216265IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-27216301IPR009057Homeodomain-like
PROSITE profilePS5129423.711216267IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-20217265IPR009057Homeodomain-like
PfamPF002495.8E-18217262IPR001005SANT/Myb domain
CDDcd001674.34E-15219261No hitNo description
PfamPF002491.5E-12264302IPR001005SANT/Myb domain
CDDcd001673.00E-10264302No hitNo description
SMARTSM007177.5E-8266307IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-16266306IPR009057Homeodomain-like
PROSITE profilePS5129412.86268309IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MLEDGMDKHG ASRGGGHRRF IRHHQEKNWA SSVWSWARTT ITTSRRCFRG RVVPSPLHFC  60
PAFRLSPSAH LRASARRRRI VFELCSVQVL RVACSELRNL VEQQQNNETK MYERSGAGAV  120
TIPELPGGRC QFPYVPWPLH GPGPNPQRNH EPFPTTPQND KRGRVRLCEV APQFATRALG  180
DSCIAGQVTG RRATINTYRV YLIFSTTTSL PQLLAIRGPW SPEEDDMLRR LVERHGARNW  240
TTIGREIPGR SGKSCRLRWC NQLSPQEDAA IVRAHARLGN RWAAIARLLP GRTDNAVKNH  300
WNCSLKRKLA AANAEPGAED AVEFERPCKR ANLSPDSPDL SHGASSGSGQ IYRPVARSGG  360
FEPVDCAMSR RRHVEDPLTS LSLSLPGMDN GFHHDRAHSQ FQVLPASPSP PPPPPPAAPA  420
AAPVPAAASY PFNPEFMAAM QDLIRTEVQR YMVSVGVRAG CGGAAVGAEM FMPQLMEGVM  480
RAAAERVGAV GRMHHPCDRT FMRGHLPAGK ETADLELAAR RRRRVSECSH RGTKSKERRG  540
PPRSHVGRPC SGAGRIRLCF RSLARAGGPS QDLSAHHACE VPRKRCPGKY TVPTAEVLAC  600
HQPPVVCLPA RGPWMGTVRS FERELATGRC VDGSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-322103092108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154